PDB entry 1j82

View 1j82 on RCSB PDB site
Description: osmolyte stabilization of rnase
Deposited on 2001-05-19, released 2001-06-06
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1j82.1
  • Chain 'B':
    Domains in SCOP 1.59: d1j82.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j82A (A:)
ketaaakferqhmds

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j82B (B:)
nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
cretgsskypncaykttqankhiivacegnpyvpvhfdasv