PDB entry 1j7z

View 1j7z on RCSB PDB site
Description: Osmolyte Stabilization of Ribonuclease
Class: hydrolase
Keywords: osmolyte soaking, sarcosine, trimethylamine-n-oxide, betaine, taurine, hydrolase
Deposited on 2001-05-19, released 2001-06-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1j7z.1
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1j7z.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1j7zA (A:)
ketaaakferqhmds

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1j7zB (B:)
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

    Sequence, based on observed residues (ATOM records): (download) 
    >1j7zB (B:)
nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
cretgsskypncaykttqankhiivacegnpyvpvhfdasv