PDB entry 1j7w

View 1j7w on RCSB PDB site
Description: Crystal structure of deoxy HbbetaYQ, a site directed mutant of HbA
Class: oxygen storage/transport
Keywords: globin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2001-05-19, released 2002-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: HBA HUMAN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
    Domains in SCOPe 2.05: d1j7wa_
  • Chain 'B':
    Compound: hemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: HBB HUMAN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (27)
      • engineered (62)
    Domains in SCOPe 2.05: d1j7wb_
  • Chain 'C':
    Compound: hemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: HBA HUMAN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
    Domains in SCOPe 2.05: d1j7wc_
  • Chain 'D':
    Compound: hemoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: HBB HUMAN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (27)
      • engineered (62)
    Domains in SCOPe 2.05: d1j7wd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wB (B:)
    mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
    kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wC (C:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wD (D:)
    mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
    kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh