PDB entry 1j7w

View 1j7w on RCSB PDB site
Description:
Deposited on 2001-05-19, released 2002-02-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1j7wa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1j7wb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1j7wc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1j7wd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wB (B:)
    mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
    kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wC (C:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7wD (D:)
    mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
    kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh