PDB entry 1j7v

View 1j7v on RCSB PDB site
Description: human il-10 / il-10r1 complex
Class: cytokine/receptor
Keywords: cytokine receptor complex, 4 helix bundle, class 2 receptor, interleukin-10, CYTOKINE/RECEPTOR COMPLEX
Deposited on 2001-05-18, released 2001-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: interleukin-10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j7vl_
  • Chain 'R':
    Compound: interleukin-10 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13651
      • engineered (28)
      • engineered (52)
      • engineered (88)
      • engineered (132)
      • engineered (155)
      • engineered (167)
    Domains in SCOPe 2.07: d1j7vr1, d1j7vr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1j7vL (L:)
    spgqgtqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgyl
    gcqalsemiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkska
    veqvknafnklqekgiykamsefdifinyieaymtmkirn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7vL (L:)
    scthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiq
    fyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnk
    lqekgiykamsefdifinyieaymtmkirn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1j7vR (R:)
    hgtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsy
    dltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilg
    kiqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgef
    cvqvkpsvasrsnkgmwskeecisltrqyftvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7vR (R:)
    gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
    ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvdevtltvgsvnleihngfilgk
    iqlprpkmapaqdtyesifshfreyeiairkvpgqftfthkkvkheqfslltsgevgefc
    vqvkpsvasrsnkgmwskeecislt