PDB entry 1j7q

View 1j7q on RCSB PDB site
Description: Solution structure and backbone dynamics of the defunct EF-hand domain of Calcium Vector Protein
Class: metal binding protein
Keywords: EF-HAND family, Calcium Binding Protein, NMR, METAL BINDING PROTEIN
Deposited on 2001-05-18, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium vector protein
    Species: Branchiostoma lanceolatum [TaxId:7740]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j7qa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7qA (A:)
    aapkaralgpeekdecmkifdifdrnaeniapvsdtmdmltklgqtytkreteaimkear
    gpkgdkknigpeewltlcskwvrqdd