PDB entry 1j7p

View 1j7p on RCSB PDB site
Description: Solution structure of Calcium calmodulin C-terminal domain
Class: metal binding protein
Keywords: EF hands, helix bundle, calcium, dipolar coupling, METAL BINDING PROTEIN
Deposited on 2001-05-17, released 2001-11-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1j7pa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7pA (A:)
    eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
    vqmmtak