PDB entry 1j7p

View 1j7p on RCSB PDB site
Description: solution structure of calcium calmodulin c-terminal domain
Deposited on 2001-05-17, released 2001-11-07
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: NMR3
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1j7pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j7pA (A:)
  eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef
  vqmmtak