PDB entry 1j7m

View 1j7m on RCSB PDB site
Description: the third fibronectin type ii module from human matrix metalloproteinase 2
Deposited on 2001-05-17, released 2001-05-30
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: NMR50
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1j7ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7mA (A:)
    swmstvggnsggapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdqg