PDB entry 1j7m

View 1j7m on RCSB PDB site
Description: The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2
Class: hydrolase
Keywords: beta sheet, alpha helix, HYDROLASE
Deposited on 2001-05-17, released 2001-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix metalloproteinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08253 (10-67)
      • cloning artifact (8-9)
      • see remark 999 (18)
    Domains in SCOPe 2.08: d1j7ma1, d1j7ma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j7mA (A:)
    laahppfaswmstvggnsggapcvfpftflgnkyesctsagrsdgkmwcattanydddrk
    wgfcpdqgwiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7mA (A:)
    swmstvggnsggapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdqg