PDB entry 1j7k

View 1j7k on RCSB PDB site
Description: thermotoga maritima ruvb p216g mutant
Class: DNA binding protein
Keywords: AAA+-Class ATPase, Winged-Helix Domain, DNA Translocase, Holliday Junction, Branch Migration, Walker A, Walker B, Sensor 1, Sensor 2, Arginine Finger, DNA BINDING PROTEIN
Deposited on 2001-05-16, released 2001-08-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: holliday junction DNA helicase ruvb
    Species: Thermotoga maritima [TaxId:2336]
    Gene: RUVB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56313
      • engineered (215)
    Domains in SCOPe 2.01: d1j7ka1, d1j7ka2
  • Heterogens: ACT, CO, ATP, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j7kA (A:)
    msefltpertvydsgvqflrpksldefigqenvkkklslaleaakmrgevldhvllagpp
    glgkttlahiiaselqtnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkavee
    llysaiedfqidimigkgpsaksiridiqpftlvgattrsgllssplrsrfgiileldfy
    tvkelkeiikraaslmdveiedaaaemiakrsrgtgriairltkrvrdmltvvkadrint
    divlktmevlniddegldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepy
    llqagflartprgrivtekaykhlkyevpenrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7kA (A:)
    lrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselqtn
    ihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidiidiqp
    ftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemiak
    rsrgtgriairltkrvrdmltvvkadrintdivlktmevlniddegldefdrkilktiie
    iyrggpvglnalaaslgveadtlsevyepyllqagflartprgrivtekaykhlkyevp