PDB entry 1j7k

View 1j7k on RCSB PDB site
Description:
Deposited on 2001-05-16, released 2001-08-08
The last revision prior to the SCOP 1.61 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1j7ka1, d1j7ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j7kA (A:)
    lrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselqtn
    ihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimigkg
    psaksiridiqpftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdv
    eiedaaaemiakrsrgtgriairltkrvrdmltvvkadrintdivlktmevlniddegld
    efdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgrivte
    kaykhlkyevp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7kA (A:)
    lrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselqtn
    ihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidiidiqp
    ftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemiak
    rsrgtgriairltkrvrdmltvvkadrintdivlktmevlniddegldefdrkilktiie
    iyrggpvglnalaaslgveadtlsevyepyllqagflartprgrivtekaykhlkyevp