PDB entry 1j7d

View 1j7d on RCSB PDB site
Description: Crystal Structure of hMms2-hUbc13
Class: unknown function
Keywords: Ubiquitin, Ubc, DNA repair, Traf6, NFkB,, unknown function
Deposited on 2001-05-16, released 2001-08-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mms2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j7da_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2-17 kda
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j7db_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j7dA (A:)
    mavstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyen
    riyslkvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlq
    elrrlmmskenmklpqppegqtynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7dA (A:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j7dB (B:)
    maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
    eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
    landvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7dB (B:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
    andvaeqwktneaqaietarawtrlyamn