PDB entry 1j7d

View 1j7d on RCSB PDB site
Description:
Deposited on 2001-05-16, released 2001-08-08
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-30, with a file datestamp of 2003-09-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1j7da_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1j7db_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j7dA (A:)
    mavstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyen
    riyslkvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlq
    elrrlmmskenmklpqppegqtynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7dA (A:)
    gvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriysl
    kvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrl
    mmskenmklpqppegqtynn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j7dB (B:)
    maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
    eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
    landvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j7dB (B:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
    andvaeqwktneaqaietarawtrlyamn