PDB entry 1j7c

View 1j7c on RCSB PDB site
Description: structure of the anabaena ferredoxin mutant e95k
Deposited on 2001-05-16, released 2001-05-23
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1j7ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7cA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkekdly