PDB entry 1j7b

View 1j7b on RCSB PDB site
Description: structure of the anabaena ferredoxin mutant e94k
Deposited on 2001-05-16, released 2001-05-23
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1j7ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j7bA (A:)
  atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
  sdqsfldddqieagyvltcvayptsdvviqthkkedly