PDB entry 1j79

View 1j79 on RCSB PDB site
Description: Molecular Structure of Dihydroorotase: A Paradigm for Catalysis Through the Use of a Binuclear Metal Center
Class: hydrolase
Keywords: TIM barrel, metalloenzyme, pyrimidine biosynthesis
Deposited on 2001-05-16, released 2001-06-20
The last revision prior to the SCOP 1.73 freeze date was dated 2001-06-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Escherichia coli
    Gene: PYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05020
      • see remark 999 (68)
      • modified residue (101)
      • see remark 999 (118)
      • see remark 999 (242)
    Domains in SCOP 1.73: d1j79a_
  • Chain 'B':
    Compound: dihydroorotase
    Species: Escherichia coli
    Gene: PYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05020
      • see remark 999 (68)
      • modified residue (101)
      • see remark 999 (118)
      • see remark 999 (242)
    Domains in SCOP 1.73: d1j79b_
  • Heterogens: ZN, ORO, NCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j79A (A:)
    tapsqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrq
    rildavpaphdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvd
    aimpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehitt
    kdaadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvas
    gfqrvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngp
    qfyglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j79A (A:)
    sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
    davpaphdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
    pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
    adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfq
    rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
    glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j79B (B:)
    tapsqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrq
    rildavpaphdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvd
    aimpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehitt
    kdaadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvas
    gfqrvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngp
    qfyglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j79B (B:)
    sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
    davpaphdftplmtcyltdsldpnelergfnegvftaaklypanashgvtsvdaimpvle
    rmekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkdaadyv
    rdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfqrvfl
    gtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfyglpv
    ndtfielvreeqqvaesialtddtlvpflagetvrwsvk