PDB entry 1j77

View 1j77 on RCSB PDB site
Description: Crystal Structure of Gram-negative Bacterial Heme Oxygenase Complexed with Heme
Class: oxidoreductase
Keywords: proximal histidine, distal helix, OXIDOREDUCTASE
Deposited on 2001-05-15, released 2001-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.229
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HemO
    Species: Neisseria meningitidis [TaxId:487]
    Gene: hemO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1j77a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j77A (A:)
    msetenqaltfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiy
    kdaelnkaipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlg
    aaflfkhaqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgarea
    fafykvvlretfglaadaeapegmmphrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j77A (A:)
    altfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiykdaelnk
    aipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlgaaflfkh
    aqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgareafafykvv
    lretfglaadaeapegmmph