PDB entry 1j75

View 1j75 on RCSB PDB site
Description: Crystal Structure of the DNA-Binding Domain Zalpha of DLM-1 Bound to Z-DNA
Deposited on 2001-05-15, released 2001-09-01
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-01, with a file datestamp of 2001-09-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.22152
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1j75a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j75A (A:)
    nleqkilqvlsddggpvkigqlvkkcqvpkktlnqvlyrlkkedrvsspepatwsig