PDB entry 1j74

View 1j74 on RCSB PDB site
Description: Crystal Structure of Mms2
Class: unknown function
Keywords: Mms2, Uev, Ubiquitin, Ubc, DNA repair, UNKNOWN FUNCTION
Deposited on 2001-05-15, released 2001-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mms2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j74a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j74A (A:)
    mavstgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyen
    riyslkvecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlq
    elrrlmmskenmklpqppegqtynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j74A (A:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
    vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqtynn