PDB entry 1j72

View 1j72 on RCSB PDB site
Description: Crystal Structure of Mutant Macrophage Capping Protein (Cap G) with Actin-severing Activity in the Ca2+-Free Form
Class: structural protein
Keywords: actin, human, capping, cap g, macrophage, gCap39, Mbhl, gelsolin, structural protein
Deposited on 2001-05-15, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage capping protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40121 (Start-346)
      • see remark 999 (82-89)
      • see remark 999 (123-136)
    Domains in SCOPe 2.06: d1j72a1, d1j72a2, d1j72a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j72A (A:)
    mytaipqsgspfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevsh
    lhlwigqqssrdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqegg
    vesgfkhvvpnevvvqrlyqvkgkknirateralnwdsfntgdcfildlgqnifawcggk
    snilernkardlalairdserqgkaqveivtdgeepaemiqvlgpkpalkegnpeedlta
    dkanaqaaalykvsdatgqmnltkvadsspfalellisddcfvldnglcgkiyiwkgrka
    nekerqaalqvaegfisrmqyapntqveilpqgrespifkqffkdwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j72A (A:)
    pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss
    rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesgfkhvvp
    nevvvqrlyqvkgkknirateralnwdsfntgdcfildlgqnifawcggksnilernkar
    dlalairdserqgkaqveivtdgeepaemiqvlgpkpalkegnpeedltadkanaqaaal
    ykvsdatgqmnltkvadsspfalellisddcfvldnglcgkiyiwkgrkanekerqaalq
    vaegfisrmqyapntqveilpqgrespifkqffkdwk