PDB entry 1j6y

View 1j6y on RCSB PDB site
Description: Solution structure of Pin1At from Arabidopsis thaliana
Class: isomerase
Keywords: prolyl cis/trans isomerase, parvulin, PIN1, phosphorylation
Deposited on 2001-05-15, released 2002-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SL42 (20-138)
      • expression tag (19)
    Domains in SCOPe 2.06: d1j6ya1, d1j6ya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6yA (A:)
    mgsshhhhhhssglvprgshmasrdqvkashilikhqgsrrkaswkdpegkiiltttrea
    aveqlksiredivsgkanfeevatrvsdcssakrggdlgsfgrgqmqkpfeeatyalkvg
    disdivdtdsgvhiikrta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6yA (A:)
    hmasrdqvkashilikhqgsrrkaswkdpegkiiltttreaaveqlksiredivsgkanf
    eevatrvsdcssakrggdlgsfgrgqmqkpfeeatyalkvgdisdivdtdsgvhiikrta