PDB entry 1j6x

View 1j6x on RCSB PDB site
Description: crystal structure of helicobacter pylori luxs
Class: signaling protein
Keywords: alpha-beta fold, SIGNALING PROTEIN
Deposited on 2001-05-14, released 2001-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.219
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMW8 (0-End)
      • cloning artifact (0)
      • cloning artifact (2)
      • cloning artifact (48)
      • cloning artifact (50)
      • cloning artifact (77)
      • cloning artifact (104)
    Domains in SCOPe 2.05: d1j6xa_
  • Chain 'B':
    Compound: autoinducer-2 production protein luxs
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMW8 (0-151)
      • cloning artifact (0)
      • cloning artifact (2)
      • cloning artifact (48)
      • cloning artifact (50)
      • cloning artifact (77)
      • cloning artifact (104)
    Domains in SCOPe 2.05: d1j6xb_
  • Heterogens: ZN, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6xA (A:)
    mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
    vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
    qcgwaanhtlegaqnlarafldkraewsevgvgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6xA (A:)
    mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
    vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
    qcgwaanhtlegaqnlarafldkraewsevg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j6xB (B:)
    mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
    vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
    qcgwaanhtlegaqnlarafldkraewsevgvgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6xB (B:)
    mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
    vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
    qcgwaanhtlegaqnlarafldkraewsevgv