PDB entry 1j6x

View 1j6x on RCSB PDB site
Description: crystal structure of helicobacter pylori luxs
Deposited on 2001-05-14, released 2001-06-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-08, with a file datestamp of 2001-06-08.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1j6xa_
  • Chain 'B':
    Domains in SCOP 1.57: d1j6xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j6xA (A:)
    mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
    vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
    qcgwaanhtlegaqnlarafldkraewsevg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j6xB (B:)
    mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
    vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
    qcgwaanhtlegaqnlarafldkraewsevgv