PDB entry 1j6w

View 1j6w on RCSB PDB site
Description: crystal structure of haemophilus influenzae luxs
Class: signaling protein
Keywords: alpha-beta fold, SIGNALING PROTEIN
Deposited on 2001-05-14, released 2001-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44007
      • cloning artifact (13)
      • cloning artifact (24)
      • cloning artifact (63)
      • cloning artifact (80)
      • cloning artifact (88)
      • cloning artifact (107)
    Domains in SCOPe 2.08: d1j6wa_
  • Chain 'B':
    Compound: autoinducer-2 production protein luxs
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44007
      • cloning artifact (13)
      • cloning artifact (24)
      • cloning artifact (63)
      • cloning artifact (80)
      • cloning artifact (88)
      • cloning artifact (107)
    Domains in SCOPe 2.08: d1j6wb_
  • Heterogens: ZN, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6wA (A:)
    mplldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlf
    agfmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasi
    pelniyqcgsytehsledaheiaknviargigvnknedlsldnsllkgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6wA (A:)
    lldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfag
    fmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipe
    lniyqcgsytehsledaheiaknviargigvnknedlsldn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j6wB (B:)
    mplldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlf
    agfmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasi
    pelniyqcgsytehsledaheiaknviargigvnknedlsldnsllkgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6wB (B:)
    lldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfag
    fmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipe
    lniyqcgsytehsledaheiaknviargigvnknedlsld