PDB entry 1j6v

View 1j6v on RCSB PDB site
Description: crystal structure of d. radiodurans luxs, c2
Class: signaling protein
Keywords: alpha-beta fold, SIGNALING PROTEIN
Deposited on 2001-05-14, released 2001-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRU8
      • cloning artifact (66)
      • cloning artifact (79)
      • cloning artifact (85)
      • cloning artifact (87)
      • cloning artifact (99)
    Domains in SCOPe 2.05: d1j6va_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6vA (A:)
    mpdmanvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtle
    hllagymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgv
    selecgnyrdhdlaaarqhardvldqglkvqetillergshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6vA (A:)
    vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
    mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
    nyrdhdlaaarqhardvldqglkvqetille