PDB entry 1j6u

View 1j6u on RCSB PDB site
Description: Crystal structure of UDP-N-acetylmuramate-alanine ligase MurC (TM0231) from Thermotoga maritima at 2.3 A resolution
Class: ligase
Keywords: STRUCTURAL GENOMICS, TM0231, UDP-N-acetylmuramate-alanine ligase MurC, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2002-08-29, released 2002-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylmuramate-alanine ligase MurC
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0231
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY73 (12-End)
      • expression tag (11)
      • modified residue (12)
      • modified residue (24)
      • modified residue (92)
      • modified residue (130)
      • modified residue (150)
      • modified residue (246)
      • modified residue (257)
      • modified residue (401)
    Domains in SCOPe 2.06: d1j6ua1, d1j6ua2, d1j6ua3, d1j6ua4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6uA (A:)
    mgsdkihhhhhhmkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipi
    fvphsadnwydpdlviktpavrddnpeivrarmervpienrlhyfrdtlkrekkeefavt
    gtdgkttttamvahvlkhlrksptvflggimdslehgnyekgngpvvyeldeseeffsef
    spnyliitnargdhlenygnsltryrsafekisrntdlvvtfaedeltshlgdvtfgvkk
    gtytlemrsasraeqkamvekngkrylelklkvpgfhnvlnalavialfdslgydlapvl
    ealeefrgvhrrfsiafhdpetniyviddyahtpdeirnllqtakevfenekivvifqph
    rysrleredgnfakalqladevvvtevydafeekkngisgkmiwdslkslgkeayfvekl
    pelekvisvsentvflfvgagdiiyssrrfveryqssksspsrvlgsnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6uA (A:)
    hmkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipifvphsadnwyd
    pdlviktpavrddnpeivrarmervpienrlhyfrdtlkrekkeefavtgtdgkttttam
    vahvlkhlrksptvflggimdslehgnyekgngpvvyeldeseeffsefspnyliitnar
    gdhlenygnsltryrsafekisrntdlvvtfaedeltshlgdvtfgvkkgtytlemrsas
    raeqkamvekngkrylelklkvpgfhnvlnalavialfdslgydlapvlealeefrgvhr
    rfsiafhdpetniyviddyahtpdeirnllqtakevfenekivvifqphrgnfakalqla
    devvvtevydsgkmiwdslkslgkeayfveklpelekvisvsentvflfvgagdiiyssr
    rfveryqssk