PDB entry 1j6u

View 1j6u on RCSB PDB site
Description: crystal structure of udp-n-acetylmuramate-alanine ligase murc (tm0231) from thermotoga maritima at 2.3 a resolution
Deposited on 2002-08-29, released 2002-11-06
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6uA (A:)
    hmkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipifvphsadnwyd
    pdlviktpavrddnpeivrarmervpienrlhyfrdtlkrekkeefavtgtdgkttttam
    vahvlkhlrksptvflggimdslehgnyekgngpvvyeldeseeffsefspnyliitnar
    gdhlenygnsltryrsafekisrntdlvvtfaedeltshlgdvtfgvkkgtytlemrsas
    raeqkamvekngkrylelklkvpgfhnvlnalavialfdslgydlapvlealeefrgvhr
    rfsiafhdpetniyviddyahtpdeirnllqtakevfenekivvifqphrysrleredgn
    fakalqladevvvtevydafeekkngisgkmiwdslkslgkeayfveklpelekvisvse
    ntvflfvgagdiiyssrrfveryqssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6uA (A:)
    hmkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipifvphsadnwyd
    pdlviktpavrddnpeivrarmervpienrlhyfrdtlkrekkeefavtgtdgkttttam
    vahvlkhlrksptvflggimdslehgnyekgngpvvyeldeseeffsefspnyliitnar
    gdhlenygnsltryrsafekisrntdlvvtfaedeltshlgdvtfgvkkgtytlemrsas
    raeqkamvekngkrylelklkvpgfhnvlnalavialfdslgydlapvlealeefrgvhr
    rfsiafhdpetniyviddyahtpdeirnllqtakevfenekivvifqphrgnfakalqla
    devvvtevydsgkmiwdslkslgkeayfveklpelekvisvsentvflfvgagdiiyssr
    rfveryqssk