PDB entry 1j6o

View 1j6o on RCSB PDB site
Description: Crystal structure of TatD-related deoxyribonuclease (TM0667) from Thermotoga maritima at 1.8 A resolution
Class: hydrolase
Keywords: structural genomics, TM0667, TatD-related deoxyribonuclease, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2002-07-09, released 2002-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TatD-related deoxyribonuclease
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0667
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZD5 (12-267)
      • expression tag (8-11)
      • modified residue (12)
    Domains in SCOPe 2.06: d1j6oa1, d1j6oa2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6oA (A:)
    mgsdkihhhhhhmvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldl
    sktsdrifcsvgvhphdakevpedfiehlekfakdekvvaigetgldffrnispaevqkr
    vfveqielagklnlplvvhirdayseayeilrteslpekrgvihafssdyewakkfidlg
    fllgiggpvtypknealrevvkrvgleyivletdcpflppqpfrgkrnepkylkyvveti
    sqvlgvpeakvdeattenarriflevke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6oA (A:)
    hhhhmvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldlsktsdrif
    csvgvhphdakevpedfiehlekfakdekvvaigetgldffrnispaevqkrvfveqiel
    agklnlplvvhirdayseayeilrteslpekrgvihafssdyewakkfidlgfllgiggp
    vtypknealrevvkrvgleyivletdcpflppqpfrgkrnepkylkyvvetisqvlgvpe
    akvdeattenarriflevke