PDB entry 1j6n

View 1j6n on RCSB PDB site
Description: Crystal structure of Cysteine synthase (TM0665) from Thermotoga maritima at 1.8 A resolution
Class: lyase
Keywords: structural genomics, TM0665, JCSG, cysteine synthase
Deposited on 2002-07-09, released 2002-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-09-02, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Thermotoga maritima
    Gene: TM0665
    Database cross-references and differences (RAF-indexed):
    • GB AAD35748 (12-302)
      • his tag (11)
    Domains in SCOPe 2.06: d1j6na1, d1j6na2
  • Chain 'B':
    Compound: Cysteine synthase
    Species: Thermotoga maritima
    Gene: TM0665
    Database cross-references and differences (RAF-indexed):
    • GB AAD35748 (12-302)
      • his tag (11)
    Domains in SCOPe 2.06: d1j6nb1, d1j6nb2
  • Chain 'C':
    Compound: Cysteine synthase
    Species: Thermotoga maritima
    Gene: TM0665
    Database cross-references and differences (RAF-indexed):
    • GB AAD35748 (12-End)
      • his tag (11)
    Domains in SCOPe 2.06: d1j6nc1, d1j6nc2
  • Chain 'D':
    Compound: Cysteine synthase
    Species: Thermotoga maritima
    Gene: TM0665
    Database cross-references and differences (RAF-indexed):
    • GB AAD35748 (12-302)
      • his tag (10-11)
    Domains in SCOPe 2.06: d1j6nd1, d1j6nd2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j6nA (A:)
    mgsdkihhhhhhmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaek
    rgllkngiveptsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpge
    lgmkgavekaleisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtg
    gtisgvgrvlkgffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvide
    vitvedeeayemarylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaeryl
    sil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6nA (A:)
    hmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivep
    tsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekal
    eisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlk
    gffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeaye
    marylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j6nB (B:)
    mgsdkihhhhhhmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaek
    rgllkngiveptsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpge
    lgmkgavekaleisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtg
    gtisgvgrvlkgffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvide
    vitvedeeayemarylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaeryl
    sil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6nB (B:)
    hmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivep
    tsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltgavekaleisretg
    ahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkgffgngv
    kivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayemarylak
    kegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j6nC (C:)
    mgsdkihhhhhhmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaek
    rgllkngiveptsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpge
    lgmkgavekaleisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtg
    gtisgvgrvlkgffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvide
    vitvedeeayemarylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaeryl
    sil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6nC (C:)
    hmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivep
    tsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaeahmlnqfenpynvyshqf
    ttgpeilkqmdyqidafvagvgtggtisgvgrvlkgffgngvkivavepakspvlsggqp
    gkhaiqgigagfvpkildrsvidevitvedeeayemarylakkegllvgissganvaaal
    kvaqklgpdarvvtvapdhaerylsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j6nD (D:)
    mgsdkihhhhhhmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaek
    rgllkngiveptsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpge
    lgmkgavekaleisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtg
    gtisgvgrvlkgffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvide
    vitvedeeayemarylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaeryl
    sil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j6nD (D:)
    hhmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngive
    ptsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvaleisretgahmlnq
    fenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlkgffgngvkivave
    pakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeayemarylakkegllv
    gissganvaaalkvaqklgpdarvvtvapdhaerylsil