PDB entry 1j5x

View 1j5x on RCSB PDB site
Description: Crystal structure of Glucosamine-6-phosphate deaminase (TM0813) from Thermotoga maritima at 1.8 A resolution
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, TM0813, GLUCOSAMINE-6-PHOSPHATE DEAMINASE, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2002-07-05, released 2002-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine-6-phosphate deaminase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZS0 (Start-341)
      • modified residue (159)
      • modified residue (165)
      • modified residue (171)
      • modified residue (219)
      • modified residue (236)
      • modified residue (265)
      • modified residue (271)
    Domains in SCOPe 2.08: d1j5xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5xA (A:)
    mgsdkihhhhhhmsktlkeitdqknelkkffenfvlnlekteifseiqknltdevlfvgc
    gssynlaltisyyfervlkirtkaipagevafqkipdleerglaflfsrtgnttevllan
    dvlkkrnhrtigitieeesrlakesdlplvfpvreeaivmtksfsmillslmfladkiag
    nsterfselvgyspeffdiswkviekidlkehdhfvflgmseffgvslesalkciemslt
    fseaystleyrhgpkalvkkgtlvfmqkvsgmdeqekrlrkeleslgatvlevgeggdip
    vsndwksaflrtvpaqilgyqkaisrgispdkpphlektvvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5xA (A:)
    sktlkeitdqknelkkffenfvlnlekitdevlfvgcgssynlaltisyyfervlkirtk
    aipagevafqkipdleerglaflfsrtgnttevllandvlkkrnhrtigitieeesrlak
    esdlplvfpvreeaivmtksfsmillslmfladkiagnsterfselvgyspeffdiswkv
    iekidlkehdhfvflgmseffgvslesalkciemsltfseaystleyrhgpkalvkkgtl
    vfmqkvsgmdeqekrlrkeleslgatvlevgeggdipvsndwksaflrtvpaqilgyqka
    isrgispdkpphlektvvl