PDB entry 1j5u

View 1j5u on RCSB PDB site
Description: crystal structure of an archease, possible chaperone (tm1083) from thermotoga maritima at 2.0 a resolution
Class: chaperone
Keywords: archease, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, chaperone
Deposited on 2002-07-03, released 2002-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: archease, possible chaperone
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1083
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j5ua1, d1j5ua2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1j5uA (A:)
mgsdkihhhhhhmrkpiehtadiayeisgnsyeelleearnilleeegivldteekekmy
pleetedaffdtvndwileiskgwapwrikregnelkvtfrkirkkegteikaltyhllk
ferdgdvlktkvvfdt

    Sequence, based on observed residues (ATOM records): (download) 
    >1j5uA (A:)
hhhmrkpiehtadiayeisgnsyeelleearnilleeegivldteekekmypleetedaf
fdtvndwileiskgwapwrikregnelkvtfrkirkkegteikaltyhllkferdgdvlk
tkvvfdt