PDB entry 1j5t

View 1j5t on RCSB PDB site
Description: Crystal structure of indole-3-glycerol phosphate synthase (TM0140) from Thermotoga maritima at 3.0 A resolution
Class: lyase
Keywords: TM0140, STRUCTURAL GENOMICS, JCSG, INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, LYASE
Deposited on 2002-07-03, released 2002-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.24
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerol phosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56319 (13-241)
      • expression tag (9-12)
    Domains in SCOPe 2.06: d1j5ta1, d1j5ta2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5tA (A:)
    mgsdkihhhhhhmivqrrnhrflevlsgkervkiiaefkkaspsagdinadasledfirm
    ydeladaisiltekhyfkgdpafvraarnltcrpilakdfyidtvqvklassvgadaili
    iariltaeqikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintrdldtfeikk
    nvlwellplvpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenprrfleemraw
    se
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5tA (A:)
    hhhmivqrrnhrflevlsgkervkiiaefkkaspsagdinadasledfirmydeladais
    iltekhyfkgdpafvraarnltcrpilakdfyidtvqvklassvgadailiiariltaeq
    ikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintrdldtfeikknvlwellpl
    vpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenprrfleemrawse