PDB entry 1j5s

View 1j5s on RCSB PDB site
Description: Crystal structure of uronate isomerase (TM0064) from Thermotoga maritima at 2.85 A resolution
Class: isomerase
Keywords: TM0064, URONATE ISOMERASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2002-07-02, released 2002-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uronate isomerase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0064
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXR9 (12-End)
      • expression tag (11)
    Domains in SCOPe 2.06: d1j5sa1, d1j5sa2
  • Chain 'B':
    Compound: uronate isomerase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0064
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j5sb_
  • Chain 'C':
    Compound: uronate isomerase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0064
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j5sc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5sA (A:)
    mgsdkihhhhhhmflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiw
    evegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrr
    fnikkviseetaeeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeav
    egvtilptwrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcv
    asdhallepsvyyvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtq
    lhigalrdyrdslfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlp
    tistiarafpnvyvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrt
    emfrrvlsnvvgemvekgqipikearelvkhvsydgpkalffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5sA (A:)
    hmflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvw
    elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet
    aeeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeavegvtilptwrp
    dramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcvasdhallepsv
    yyvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtqlhigalrdyrd
    slfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlptistiarafpn
    vyvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrtemfrrvlsnvv
    gemvekgqipikearelvkhvsydgpkalff
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j5sB (B:)
    mgsdkihhhhhhmflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiw
    evegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrr
    fnikkviseetaeeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeav
    egvtilptwrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcv
    asdhallepsvyyvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtq
    lhigalrdyrdslfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlp
    tistiarafpnvyvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrt
    emfrrvlsnvvgemvekgqipikearelvkhvsydgpkalffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5sB (B:)
    mflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvwe
    lmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseeta
    eeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeavegvtilptwrpd
    ramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcvasdhallepsvy
    yvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtqlhigalrdyrds
    lfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlptistiarafpnv
    yvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrtemfrrvlsnvvg
    emvekgqipikearelvkhvsydgpkalff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j5sC (C:)
    mgsdkihhhhhhmflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiw
    evegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrr
    fnikkviseetaeeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeav
    egvtilptwrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcv
    asdhallepsvyyvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtq
    lhigalrdyrdslfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlp
    tistiarafpnvyvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrt
    emfrrvlsnvvgemvekgqipikearelvkhvsydgpkalffg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5sC (C:)
    mflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvwe
    lmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseeta
    eeiweetkkklpemtpqkllrdmkveilcttddpvstlehhrkakeavegvtilptwrpd
    ramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcvasdhallepsvy
    yvdenraravhekafsgekltqdeindykafmmvqfgkmnqetnwvtqlhigalrdyrds
    lfktlgpdsggdistnflriaeglryflnefdgklkivlyvldpthlptistiarafpnv
    yvgapwwfndspfgmemhlkylasvdllynlagmvtdsrkllsfgsrtemfrrvlsnvvg
    emvekgqipikearelvkhvsydgpkalff