PDB entry 1j5r

View 1j5r on RCSB PDB site
Description: Crystal structure of alcohol dehydrogenase (TM0920) from Thermotoga maritima at 1.4 A resolution
Class: oxidoreductase
Keywords: tm0920, alcohol dehydrogenase, structural genomics, jcsg
Deposited on 2002-07-03, released 2002-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2003-06-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.212
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Thermotoga maritima
    Gene: TM0920
    Database cross-references and differences (RAF-indexed):
    • GB AAD36001 (12-370)
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Thermotoga maritima
    Gene: TM0920
    Database cross-references and differences (RAF-indexed):
    • GB AAD36001 (12-370)
    Domains in SCOPe 2.06: d1j5rb1, d1j5rb2
  • Heterogens: FE, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j5rB (B:)
    mgsdkihhhhhhmwefymptdvffgekilekrgniidllgkralvvtgkssskkngsldd
    lkklldeteisyeifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavl
    lkekdlsvedlydrekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvya
    fldprytysmsdeltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaieg
    nrearkkmfvasclagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkee
    ipekvdtvnhifggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpek
    irniyrealgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5rB (B:)
    mwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisy
    eifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedly
    drekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsd
    eltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfvas
    clagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhif
    ggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv