PDB entry 1j5q

View 1j5q on RCSB PDB site
Description: The Structure and Evolution of the Major Capsid Protein of a Large, Lipid-containing, DNA virus.
Class: Viral protein
Keywords: PBCV-1, Major capsid protein of large DNA virus, Vp54, Chlorella virus, Viral protein
Deposited on 2002-06-27, released 2002-11-20
Made obsolete by 5tiq on 2017-12-20

The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.269
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j5qa1, d1j5qa2
  • Chain 'B':
    Compound: Major capsid protein
    Species: Paramecium bursaria Chlorella virus 1 [TaxId:10506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1j5qb1, d1j5qb2
  • Heterogens: NAG, MAN, NDG, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5qA (A:)
    magglsqlvaygaqdvyltgnpqitffktvyrrytnfaiesiqqtingsvgfgnkvstqi
    srngdlitdivvefvltkggnggttyypaeellqdveleiggqridkhyndwfrtydalf
    rmnddrynyrrmtdwvnnelvgaqkrfyvplifffnqtpglalplialqyhevklyftla
    sqvqgvnyngssaiagaaqptmsvwvdyifldtqertrfaqlpheylieqlqftgsetat
    psattqasqnirlnfnhptkylawnfnnptnygqytalanipgacsgagtaaatvttpdy
    gntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyqsiggvtpagvylysfalkp
    agrqpsgtcnfsridnatlsltyktcsidatspaavlgntetvtantatlltalniyakn
    ynvlrimsgmgglayan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5qA (A:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j5qB (B:)
    magglsqlvaygaqdvyltgnpqitffktvyrrytnfaiesiqqtingsvgfgnkvstqi
    srngdlitdivvefvltkggnggttyypaeellqdveleiggqridkhyndwfrtydalf
    rmnddrynyrrmtdwvnnelvgaqkrfyvplifffnqtpglalplialqyhevklyftla
    sqvqgvnyngssaiagaaqptmsvwvdyifldtqertrfaqlpheylieqlqftgsetat
    psattqasqnirlnfnhptkylawnfnnptnygqytalanipgacsgagtaaatvttpdy
    gntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyqsiggvtpagvylysfalkp
    agrqpsgtcnfsridnatlsltyktcsidatspaavlgntetvtantatlltalniyakn
    ynvlrimsgmgglayan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5qB (B:)
    tffktvyrrytnfaiesiqqtingsvgfgnkvstqisrngdlitdivvefvltkggnggt
    tyypaeellqdveleiggqridkhyndwfrtydalfrmnddrynyrrmtdwvnnelvgaq
    krfyvplifffnqtpglalplialqyhevklyftlasqvqgvnyngssaiagaaqptmsv
    wvdyifldtqertrfaqlpheylieqlqftgsetatpsattqasqnirlnfnhptkylaw
    nfnnptnygqytalanipgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqd
    rfatrkgsyfnkvqpyqsiggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyk
    tcsidatspaavlgntetvtantatlltalniyaknynvlrimsgmgglayan