PDB entry 1j5p

View 1j5p on RCSB PDB site
Description: Crystal structure of aspartate dehydrogenase (TM1643) from Thermotoga maritima at 1.9 A resolution
Class: oxidoreductase
Keywords: TM1643, ASPARTATE DEHYDROGENASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2002-06-27, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate dehydrogenase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1643
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1X6 (12-252)
      • expression tag (10-11)
    Domains in SCOPe 2.07: d1j5pa3, d1j5pa4, d1j5pa5
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5pA (A:)
    mgsdkihhhhhhmtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsd
    vstvvecaspeavkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsg
    aiggldvlssikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvast
    iglivgfekvkvtivadpamdhnihivrissaignyefkienipspenpktsmltvysil
    rtlrnleskiifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5pA (A:)
    hhmtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecasp
    eavkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgaiggldvlss
    ikdfvknvrietikppkslgldlkgktvvfegsveeasklfprninvastiglivgfekv
    kvtivadpamdhnihivrissaignyefkienismltvysilrtlrnleskiifg