PDB entry 1j5o

View 1j5o on RCSB PDB site
Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded DNA template-primer
Class: transferase/immune system/DNA
Keywords: hiv, reverse transcriptase, met184ile, 3tc, protein-DNA complex, drug resistance, m184i
Deposited on 2002-05-24, released 2002-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.262
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-557)
      • engineered (183)
      • engineered (279)
    Domains in SCOP 1.73: d1j5oa1, d1j5oa2
  • Chain 'B':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-429)
      • engineered (183)
      • engineered (279)
    Domains in SCOP 1.73: d1j5ob_
  • Chain 'H':
    Compound: antibody (heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1j5oh1, d1j5oh2
  • Chain 'L':
    Compound: antibody (light chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1j5ol1, d1j5ol2
  • Chain 'P':
    Compound: 5'-d(*gp*tp*cp*cp*cp*tp*gp*tp*tp*cp*gp*gp*gp*cp*gp*cp*cp*a)-3'
  • Chain 'T':
    Compound: 5'-d(*ap*tp*gp*gp*cp*gp*cp*cp*cp*gp*ap*ap*cp*ap*gp*gp*gp*ap*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5oA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5oB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqle
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5oH (H:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssaattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j5oL (L:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqdskdstysmsstlt
    ltadeyeaansytcaathktstspivksfnanec
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.