PDB entry 1j5n

View 1j5n on RCSB PDB site
Description: solution structure of the non-sequence-specific hmgb protein nhp6a in complex with sry dna
Deposited on 2002-05-15, released 2002-10-16
The last revision prior to the SCOP 1.69 freeze date was dated 2002-10-16, with a file datestamp of 2002-10-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1j5na_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j5nA (A:)
  mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
  altpeekqpyeakaqadkkryesekelynatla