PDB entry 1j5n

View 1j5n on RCSB PDB site
Description: Solution Structure of the Non-Sequence-Specific HMGB protein NHP6A in complex with SRY DNA
Class: DNA binding protein/DNA
Keywords: hmg-box, hmgb, protein-DNA complex, alpha helix, double helix, DNA binding protein/DNA complex
Deposited on 2002-05-15, released 2002-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nonhistone chromosomal protein 6A
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11632 (0-92)
  Domains in SCOPe 2.08: d1j5na_
• Chain 'B':
  Compound: 5'-d(*gp*gp*gp*gp*tp*gp*ap*tp*tp*gp*tp*tp*cp*ap*g)-3'
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: 5'-d(*cp*tp*gp*ap*ap*cp*ap*ap*tp*cp*ap*cp*cp*cp*c)-3'
  Species: synthetic, synthetic
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j5nA (A:)
  mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
  altpeekqpyeakaqadkkryesekelynatla
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.