PDB entry 1j5k

View 1j5k on RCSB PDB site
Description: complex of the kh3 domain of hnrnp k with a single_stranded 10mer DNA oligonucleotide
Class: transcription/DNA
Keywords: single-stranded DNA binding protein, transcription factor, hnrnp k, ct element, c-myc oncogene
Deposited on 2002-05-13, released 2002-07-10
The last revision prior to the SCOP 1.73 freeze date was dated 2002-07-10, with a file datestamp of 2007-06-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoprotein K
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1j5ka_
  • Chain 'B':
    Compound: 5'-d(*ap*tp*ap*t*tp*cp*cp*cp*tp*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1j5kA (A:)
gshmsygdlggpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedri
ititgtqdqiqnaqyllqnsvkqysgkff

    Sequence, based on observed residues (ATOM records): (download) 
    >1j5kA (A:)
ggpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtqdq
iqnaqyllqnsvkqys

  • Chain 'B':
    No sequence available.