PDB entry 1j5k

View 1j5k on RCSB PDB site
Description: complex of the kh3 domain of hnrnp k with a single_stranded 10mer dna oligonucleotide
Deposited on 2002-05-13, released 2002-07-10
The last revision prior to the SCOP 1.71 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1j5ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1j5kA (A:)
gshmsygdlggpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedri
ititgtqdqiqnaqyllqnsvkqysgkff

    Sequence, based on observed residues (ATOM records): (download) 
    >1j5kA (A:)
ggpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtqdq
iqnaqyllqnsvkqys