PDB entry 1j5d

View 1j5d on RCSB PDB site
Description: solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
Deposited on 2002-04-02, released 2002-04-10
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1j5da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j5dA (A:)
  anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
  lafaagesftstftepgtytyycephrgagmvgkvvvd