PDB entry 1j56

View 1j56 on RCSB PDB site
Description: minimized average structure of beryllofluoride-activated ntrc receiver domain: model structure incorporating active site contacts
Deposited on 2002-01-10, released 2003-08-19
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1j56a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j56A (A:)
    mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
    dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
    hyqe