PDB entry 1j55

View 1j55 on RCSB PDB site
Description:
Deposited on 2002-01-25, released 2003-01-07
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1j55a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j55A (A:)
    mteletamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
    ldangdaqvdfsefivfvaaitsachkyfekagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j55A (A:)
    mteletamgmiidvfsrysgsegstqtltkgelkvlmekelpgfldavdkllkdldangd
    aqvdfsefivfvaaitsachkyfekagl