PDB entry 1j55

View 1j55 on RCSB PDB site
Description: The Crystal Structure of Ca+-bound Human S100P Determined at 2.0A Resolution by X-ray
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2002-01-25, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100P protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j55a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j55A (A:)
    mteletamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
    ldangdaqvdfsefivfvaaitsachkyfekaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j55A (A:)
    mteletamgmiidvfsrysgsegstqtltkgelkvlmekelpgfldavdkllkdldangd
    aqvdfsefivfvaaitsachkyfekagl