PDB entry 1j53

View 1j53 on RCSB PDB site
Description: Structure of the N-terminal Exonuclease Domain of the Epsilon Subunit of E.coli DNA Polymerase III at pH 8.5
Class: transferase
Keywords: DNA polymerase proofreading domain, TRANSFERASE
Deposited on 2002-01-22, released 2002-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III, epsilon chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1j53a_
  • Heterogens: MN, TMP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j53A (A:)
    mstaitrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdp
    eafgvhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipk
    tntfckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg
    gqtsma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j53A (A:)
    rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
    giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
    vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg