PDB entry 1j51

View 1j51 on RCSB PDB site
Description: crystal structure of cytochrome p450cam mutant (f87w/y96f/v247l/c334a) with 1,3,5-trichlorobenzene
Class: oxidoreductase
Keywords: cytochrome p450-cam, oxidoreductase
Deposited on 2002-01-05, released 2002-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (86)
      • engineered (95)
      • engineered (246)
      • engineered (333)
    Domains in SCOPe 2.07: d1j51a_
  • Chain 'B':
    Compound: cytochrome p450cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (86)
      • engineered (95)
      • engineered (246)
      • engineered (333)
    Domains in SCOPe 2.07: d1j51b_
  • Chain 'C':
    Compound: cytochrome p450cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (86)
      • engineered (95)
      • engineered (246)
      • engineered (333)
    Domains in SCOPe 2.07: d1j51c_
  • Chain 'D':
    Compound: cytochrome p450cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-413)
      • engineered (86)
      • engineered (95)
      • engineered (246)
      • engineered (333)
    Domains in SCOPe 2.07: d1j51d_
  • Heterogens: K, HEM, TCZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j51A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcgllllggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j51A (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j51B (B:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcgllllggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j51B (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j51C (C:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcgllllggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j51C (C:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j51D (D:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcgllllggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j51D (D:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav