PDB entry 1j4z

View 1j4z on RCSB PDB site
Description: Structural and mechanistic basis for allostery in the bacterial chaperonin GroEL; see remark 400
Class: chaperone
Keywords: Wild Type GroEL, ALLOSTERY, CHAPERONE
Deposited on 2002-01-02, released 2003-11-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.52 Å
R-factor: 0.291
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4za1, d1j4za2, d1j4za3
  • Chain 'B':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zb1, d1j4zb2, d1j4zb3
  • Chain 'C':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zc1, d1j4zc2, d1j4zc3
  • Chain 'D':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zd1, d1j4zd2, d1j4zd3
  • Chain 'E':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4ze1, d1j4ze2, d1j4ze3
  • Chain 'F':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zf1, d1j4zf2, d1j4zf3
  • Chain 'G':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zg1, d1j4zg2, d1j4zg3
  • Chain 'H':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zh1, d1j4zh2, d1j4zh3
  • Chain 'I':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zi1, d1j4zi2, d1j4zi3
  • Chain 'J':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zj1, d1j4zj2, d1j4zj3
  • Chain 'K':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zk1, d1j4zk2, d1j4zk3
  • Chain 'L':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zl1, d1j4zl2, d1j4zl3
  • Chain 'M':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zm1, d1j4zm2, d1j4zm3
  • Chain 'N':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (396)
      • see remark 999 (432)
    Domains in SCOPe 2.03: d1j4zn1, d1j4zn2, d1j4zn3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j4zA (A:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zA (A:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j4zB (B:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zB (B:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j4zC (C:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zC (C:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j4zD (D:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zD (D:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j4zE (E:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zE (E:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j4zF (F:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zF (F:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1j4zG (G:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zG (G:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1j4zH (H:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zH (H:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1j4zI (I:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zI (I:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1j4zJ (J:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zJ (J:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1j4zK (K:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zK (K:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1j4zL (L:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zL (L:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1j4zM (M:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zM (M:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1j4zN (N:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zN (N:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk