PDB entry 1j4z

View 1j4z on RCSB PDB site
Description:
Deposited on 2002-01-02, released 2003-11-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 3.52 Å
R-factor: 0.291
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j4zA (A:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zA (A:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j4zB (B:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zB (B:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j4zC (C:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zC (C:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j4zD (D:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zD (D:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1j4zE (E:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zE (E:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1j4zF (F:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zF (F:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1j4zG (G:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zG (G:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1j4zH (H:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zH (H:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1j4zI (I:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zI (I:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1j4zJ (J:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zJ (J:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1j4zK (K:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zK (K:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1j4zL (L:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zL (L:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1j4zM (M:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zM (M:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1j4zN (N:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j4zN (N:)
    aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtaaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarveaalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk